PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn374211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 125aa    MW: 14046.6 Da    PI: 3.8642
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn374211genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.94e-071645130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     rg+WT eEd ll+++++  G g W++ a+ 
       Achn374211 16 RGPWTLEEDTLLINYIACQGEGKWNLLAKF 45
                     89************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.6091144IPR017877Myb-like domain
SuperFamilySSF466894.79E-81248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-91249IPR009057Homeodomain-like
CDDcd001670.001161845No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MAIVRNASEE EFELRRGPWT LEEDTLLINY IACQGEGKWN LLAKFAELPE NLQYPTSPTH  60
AFGSLLNDCH YDMEAFNLGP MSEAGTGDFL LSDGQMAGGD WTSDDMAGTV WNMEEFWQFK  120
KPEE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.24e-14myb domain protein 78